Recombinant Mouse Elastin (Eln), partial

In Stock Promotion
Code CSB-EP007617MO
MSDS
Size US$388
Order now
Promotion
Promotional price as low as $99
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007617MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Eln.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP007617MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Eln.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Eln
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ElnElastin; Tropoelastin
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
266-443aa
Target Protein Sequence
PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
21.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle.
Gene References into Functions
  1. Data (including data from studies in mutant mice and cells from such mice) suggest that elastin-derived peptides are involved in regulation of lipid storage in hepatocytes; thus, elastin-derived peptides may play role in development and progression of non-alcoholic fatty liver. PMID: 29802129
  2. Elastin insufficiency triggers structural defects and abnormal remodeling of renal vascular signaling involving AT1R-mediated vascular mechanotransduction and renal hyperfiltration with increased blood pressure sensitivity to dietary sodium contributing to systolic hypertension. PMID: 28754555
  3. findings strongly suggested that elastin crosslinking and LOXL1 were co-associated with liver cirrhosis, while selective inhibition of LOXL1 arrested disease progression by reducing crosslinking of elastin. PMID: 29366776
  4. Elastin-Derived Peptides Promote Abdominal Aortic Aneurysm Formation by Modulating M1/M2 Macrophage Polarization PMID: 27183603
  5. mTOR-sensitive perturbation of smooth muscle cell mechanosensing contributes to elastin aortopathy. PMID: 28751568
  6. Deficient circumferential growth is the predominant mechanism for moderate obstructive aortic disease resulting from partial elastin deficiency in Williams syndrome. PMID: 28254817
  7. Elevations of whole lung HMGB1 level were associated with impaired alveolar development and aberrant elastin production in 85% O2-exposed newborn lungs. PMID: 26982166
  8. Eln was ubiquitously present, with enrichment in regions with cardiomyocyte differentiation, while there was an inverse correlation between ColI and cardiomyocyte differentiation. PMID: 25923353
  9. Lung histology revealed aberrant elastin production and impaired lung septation in oxygen-exposed lungs, while tropoelastin, integrin alphav, fibulin-1, fibulin-2 and fibulin-4 gene expression were elevated. PMID: 25428696
  10. Data suggest that expression of elastin in uterus, vagina, and bladder is down-regulated both in naturally aging mice and in mouse model of accelerated ovarian aging; such down-regulation may lead to pelvic floor disorders. PMID: 25131766
  11. These results suggest that elastin haploinsufficiency adversely impacts pulmonary angiogenesis. PMID: 25539853
  12. The increased levels of elastin, type V collagen and tenascin C are probably the result of increased expression by fibroblastic cells; reversely, elastin influences myofibroblast differentiation. PMID: 24291458
  13. Compared to control SMCs, the modulus of Eln-/- SMCs is reduced by 40%, but is unchanged in Fbln4-/- SMCs. The Eln-/- SMC modulus is rescued by soluble or alpha elastin treatment. PMID: 24322348
  14. Elastin haploinsufficiency impedes the progression of arterial calcification in MGP-deficient mice. PMID: 23857752
  15. Fstl1 is crucial for elastin expression and deposition in mesenchyme during lung alveologenesis PMID: 24282586
  16. Eln insufficiency induced hypertension is due to increased sensitivity of the resistance vasculature to circulating ANG II and to impaired endothelium-dependent vasodilatation. PMID: 24414067
  17. Two sides of MGP null arterial disease: chondrogenic lesions dependent on transglutaminase 2 and elastin fragmentation associated with induction of adipsin. PMID: 24036114
  18. tested the hypothesis that adhesive strength varies with atherosclerotic plaque composition of collagen and elastin in apoE and MMP12 knock outs PMID: 23261250
  19. Data show that tropoelastin staining was relatively weak in the ligamentum flavum from E15 through P0, P7 was the first stage that staining intensity was observed to be substantially stronger, intensity remained relatively high until P35. PMID: 22685574
  20. the C-terminal region of tropoelastin in has a critical role in elastic fiber assembly and suggest tissue-specific differences in the elastin assembly pat PMID: 22573328
  21. Macrophage-derived macrophage metalloelastase-12 regulates elastin degradation even in progressive experimental liver fibrosis. PMID: 22223197
  22. Genetic modifiers of cardiovascular phenotype caused by elastin haploinsufficiency act by extrinsic noncomplementation. PMID: 22049077
  23. Report accelerated fatigue-induced damage to or protease-related degradation of initially competent elastic elastin fibres in fibrillin-1 deficiency that renders arteries in Marfan syndrome increasingly susceptible to dilatation, dissection, and rupture. PMID: 21730037
  24. MMP-12 leads to elastin degradation in eosinophilic meningitis caused by Angiostrongylus cantonensis. PMID: 21856305
  25. Eln(+/-) mice have decreased aortic diameter and compliance in ex vivo tests that are significant by postnatal day 7 PMID: 21536846
  26. miR-29 and miR-15 family miRNAs are involved in the down-regulation of elastin in the adult aorta. PMID: 21305018
  27. Elastin degradation might be necessary but is not sufficient to induce arterial medial calcification. PMID: 21281809
  28. TGF-beta suppresses elastin degradation by inhibiting plasmin-mediated matrix metalloproteinase 9 activation. PMID: 21356372
  29. Oxidative and nitrosative modifications of tropoelastin prevent elastic fiber assembly. PMID: 20847053
  30. Elastin insufficiency in a mouse model establishes a role for elastin dysregulation in aortic valve pathogenesis. PMID: 20576933
  31. Elastin is only necessary for normal cardiovascular structure and function in mice starting in the last few days of fetal development. PMID: 20495146
  32. Data show that elastin induces actin stress fiber organization, inhibits proliferation, regulates migration and signals via a non-integrin, heterotrimeric G-protein-coupled pathway. PMID: 12466207
  33. tropoelastin has domains that mediate elastin deposition in vitro and in vivo PMID: 12626514
  34. Coordinately expressed and regulated with fibulin 5 in lung fibroblasts and may serve a key role during lung injury and repair. PMID: 12909585
  35. elastin gene product, signaling through the VGVAPG domain, directly induces VSMC myofibrillogenesis PMID: 14614988
  36. The mechanical behavior of ELN(+/-) arteries is likely due to the reduced elastin content combined with adaptive remodeling during vascular development PMID: 15863465
  37. Low levels of elastin is associated with pulmonary emphysema PMID: 17142349
  38. developed humanized elastin mouse with elastin production controlled by human elastin gene in bacterial artificial chromosome; expression pattern of human transgene mirrors endogenous murine gene PMID: 17626896
  39. Enhanced generation of elastin peptides in S100A4/Mts1 mice may promote increased viral entry in the vessel wall. PMID: 18083765
  40. Early elastin expression and organization modify arterial aging through their impact on both vascular cell physiology and structure. PMID: 18173368
  41. In MMP-9-deficient animals, vascular inflammation continued to develop, but the incidence of elastin breakdown was significantly reduced. Elastin breakdown in the coronary artery was virtually eliminated by ablation of MMP-9 PMID: 18311803
  42. LOXL1-KO lower urogenital tract anatomical and functional phenotype resembles female pelvic floor dysfunction in humans. Elastin disorganization may lead to such functional abnormalities. PMID: 18495804
  43. At atherosclerosis-susceptible vascular branch points, the absence of a luminal elastin barrier and the presence of a dense collagen/proteoglycan matrix contribute to increased retention of LDL PMID: 18506002
  44. Elastin insufficiency predisposes to elevated pulmonary circulatory pressures through changes in elastic artery structure. PMID: 18772328
  45. Reduced elastin in mice leads to adaptive remodeling, whereas the complete lack of elastin leads to pathological remodeling and death. PMID: 19372465

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Elastin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*